PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 483435
Common NameARALYDRAFT_483435
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family FAR1
Protein Properties Length: 207aa    MW: 23955.2 Da    PI: 8.9701
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
483435genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1851.2e-2637125290
    FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
             fY++Y++++GF +r+ + ++s+++g+i  r+f C+keg+  + + k  + r++r++tr gCka+++vk +++gkw++tk+++eHnH+l+
  483435  37 FYDDYSRRLGFVMRVMSCRRSEKDGRILARRFGCNKEGHCVSIRGKFGSVRKPRPSTREGCKAMIHVKYDRSGKWVITKFVKEHNHPLV 125
             9**************************************999999989***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.7E-2437125IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MEDEDDSATK NSNNTDDFAI EPREGIEFES EDAAKMFYDD YSRRLGFVMR VMSCRRSEKD  60
GRILARRFGC NKEGHCVSIR GKFGSVRKPR PSTREGCKAM IHVKYDRSGK WVITKFVKEH  120
NHPLVVSPRE ARHTLDEKDK RIQELTIELR NKKRLCAAYK EQLDAFAKIV EEHSNQIAKK  180
VENVVNNLKE FEPLEHALLR SKQDAI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0028910.0BT002891.1 Arabidopsis thaliana clone RAFL14-97-G02 (R20421) unknown protein (At2g43280) mRNA, complete cds.
GenBankBT0044090.0BT004409.1 Arabidopsis thaliana clone U20421 unknown protein (At2g43280) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002880035.11e-153far-red impaired responsive family protein
SwissprotQ9SZL84e-26FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLD7LJZ71e-153D7LJZ7_ARALL; Far-red impaired responsive family protein
STRINGfgenesh2_kg.4__2495__AT2G43280.11e-152(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM39182855
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.11e-152FAR1 family protein